General Information

  • ID:  hor006741
  • Uniprot ID:  P68241
  • Protein name:  Glycoprotein hormones alpha chain
  • Gene name:  CGA
  • Organism:  Meleagris gallopavo (Wild turkey)
  • Family:  Glycoprotein hormones subunit alpha family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Meleagris (genus), Meleagridinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria , Theropoda , Saurischia , Dinosauria , Archosauria , Archelosauria , Sauria , Sauropsida , Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0016913 follicle-stimulating hormone activity
  • GO BP:  GO:0006590 thyroid hormone generation; GO:0007186 G protein-coupled receptor signaling pathway; GO:0008406 gonad development; GO:0010469 regulation of signaling receptor activity; GO:0010893 positive regulation of steroid biosynthetic process; GO:0030878 thyroid gland development; GO:0032275 luteinizing hormone secretion; GO:0032870 cellular response to hormone stimulus; GO:0035265 organ growth; GO:0046621 negative regulation of organ growth; GO:0046884 follicle-stimulating hormone secretion; GO:0048589 developmental growth
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016914 follicle-stimulating hormone complex; GO:0061696 pituitary gonadotropin complex

Sequence Information

  • Sequence:  FPDGEFLMQGCPECKLGENRFFSKPGAPIYQCTGCCFSRAYPTPMRSKKTMLVPKNITSEATCCVAKAFTKITLKDNVKIENHTDCHCSTCYYHKS
  • Length:  96
  • Propeptide:  MDCYRKYAAVTLTILSVFLHLLHTFPDGEFLMQGCPECKLGENRFFSKPGAPIYQCTGCCFSRAYPTPMRSKKTMLVPKNITSEATCCVAKAFTKITLKDNVKIENHTDCHCSTCYYHKS
  • Signal peptide:  MDCYRKYAAVTLTILSVFLHLLHT
  • Modification:  NA
  • Glycosylation:  T56 N-linked (GlcNAc...) asparagine;T82 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Shared alpha chain of heterodimeric glycoprotein hormones. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  11-35; 14-64; 32-86; 36-88; 63-91
  • Structure ID:  AF-P68241-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006741_AF2.pdbhor006741_ESM.pdb

Physical Information

Mass: 1249422 Formula: C471H733N127O138S13
Absent amino acids: W Common amino acids: CKT
pI: 8.42 Basic residues: 16
Polar residues: 38 Hydrophobic residues: 22
Hydrophobicity: -39.9 Boman Index: -15322
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 46.77
Instability Index: 4170.63 Extinction Coefficient cystines: 6585
Absorbance 280nm: 69.32

Literature

  • PubMed ID:  1723796
  • Title:  Cloning and sequence analysis of the common alpha-subunit complementary deoxyribonucleic acid of turkey pituitary glycoprotein hormones.
  • PubMed ID:  1701134
  • Title:  The antigenic structure of the human glycoprotein hormone alpha-subunit: II. Cross-species comparisons.